DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and KLK4

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:272 Identity:85/272 - (31%)
Similarity:129/272 - (47%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 GNFLS---QRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLY 173
            |:.:|   .::.||.:....|:||.|.|    ..|:...|.|.::..:::|:||||   .||. |
Human    21 GSLVSGSCSQIINGEDCSPHSQPWQAAL----VMENELFCSGVLVHPQWVLSAAHC---FQNS-Y 77

  Fly   174 EIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKH 238
            .|.||.|.:..:::...|         :|...:.  :.|.:|:...:.:|:.|:||:.||.....
Human    78 TIGLGLHSLEADQEPGSQ---------MVEASLS--VRHPEYNRPLLANDLMLIKLDESVSESDT 131

  Fly   239 IKPICLPITDELKEKAEQIST----YFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYRRAVP 299
            |:.|.:         |.|..|    ..|:|||...||....||...||.:.....||:.|.....
Human   132 IRSISI---------ASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYH 187

  Fly   300 LSQLCVGGG-DLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGE 363
            .|..|.||| |.:|||.|||||||.... ||.         |:||.|...|||:.:||:|||:.:
Human   188 PSMFCAGGGQDQKDSCNGDSGGPLICNG-YLQ---------GLVSFGKAPCGQVGVPGVYTNLCK 242

  Fly   364 YVQWITDTMASN 375
            :.:||..|:.::
Human   243 FTEWIEKTVQAS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 82/254 (32%)
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 82/256 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.