DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Tmprss11c

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001025468.1 Gene:Tmprss11c / 435845 MGIID:3521861 Length:431 Species:Mus musculus


Alignment Length:348 Identity:98/348 - (28%)
Similarity:153/348 - (43%) Gaps:62/348 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IEERLTEAQKAGQKV--------PADYASYLQK-------ALCGEFNGVRHFCCPSANIQHNSKV 100
            ::....:..||..||        .|.|.:.::|       .|..:..|.......|::.:.:...
Mouse   112 VKAHTVQVSKAKGKVVIHAVLKFKACYRNNVEKYWESVETTLYQKLKGQTGLLIDSSSFKFSDIA 176

  Fly   101 MSLFKD-ENFDCGN----FLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILT 160
            |.:.:| .|..||.    ....:|:.|.:.:....||.|.|  ||....|  ||..:||..:::|
Mouse   177 MPIAEDLLNTCCGRRTIIHRGHKVAGGQDAEEGEWPWQASL--QQNSVHR--CGATLISNYWLIT 237

  Fly   161 AAHC-VHGLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVV-NVGIEKHLIHEKYDARHIMHD 223
            |||| :.......:::..| ..:|           |..||..| |:     :|||.|......:|
Mouse   238 AAHCFIRAANPKDWKVSFG-FLLS-----------KPQAPRAVKNI-----IIHENYSYPAHDND 285

  Fly   224 IALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTE-NGSSSDVLLQANVPLQPR 287
            ||:::|:..|.::.:|:..|||   |..:|....|...||||||.: :|.|.::|.:..|.:...
Mouse   286 IAVVRLSSPVLYESNIRRACLP---EATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGKVKIIDN 347

  Fly   288 SACS--QAYRRAVPLSQLCVG--GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEF--GIVSQGV 346
            ..|:  :||...:....:|.|  .|.: |:|:|||||||.:...       |.:.|  ||||.| 
Mouse   348 KTCNSGKAYGGMITPGMMCAGFLKGRV-DACQGDSGGPLVSEDS-------KGIWFLAGIVSWG- 403

  Fly   347 VTCGQISLPGLYTNVGEYVQWIT 369
            ..|...:.||:||.|..|..|||
Mouse   404 DECALPNKPGVYTRVTYYRDWIT 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 9/53 (17%)
Tryp_SPc 121..371 CDD:238113 82/258 (32%)
Tmprss11cNP_001025468.1 SEA 62..157 CDD:279699 8/44 (18%)
Tryp_SPc 199..425 CDD:214473 80/258 (31%)
Tryp_SPc 200..428 CDD:238113 83/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.