DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG11841

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:260 Identity:80/260 - (30%)
Similarity:120/260 - (46%) Gaps:45/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 PWMALLRYQQF-GESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEHRISTEEDCRQQGRK 194
            |:.|.|.:::. .|.::.|||.:||.|.:||||||......::..:||||....|:.|       
  Fly    84 PFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTD------- 141

  Fly   195 KKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQIST 259
              .|.| .:.|:.....|..::...:.:||.:::|:|.|.|.::..|.|||..|     .||..:
  Fly   142 --DAEP-EDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDD-----GEQHES 198

  Fly   260 YFVTGWGTTENG-SSSDVLLQANVPLQPRSACSQAYR-RAV--------------PLSQLCVGGG 308
            :...|||..:.. ..|..||:..:         |.|: |.|              |.||||:|..
  Fly   199 FIAIGWGQKKFAQKESKKLLKVQL---------QGYKDRCVSSVDANDELPNGYEPKSQLCIGSR 254

  Fly   309 DLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITDTMA 373
            |.:|:|.||||||:.|   |..:.|......||.|.| :||....:|..||.|..::.||...:|
  Fly   255 DNKDTCNGDSGGPVLA---YHKDLACMYHVMGITSAG-ITCSTPDIPSAYTRVHYFLNWIKGELA 315

  Fly   374  373
              Fly   316  315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 79/256 (31%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 78/254 (31%)
Tryp_SPc 72..310 CDD:214473 77/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.