DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and krt8.1

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001002797.1 Gene:krt8.1 / 431676 XenbaseID:XB-GENE-876929 Length:508 Species:Xenopus tropicalis


Alignment Length:82 Identity:16/82 - (19%)
Similarity:30/82 - (36%) Gaps:23/82 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 IALLKLNRSV--PFQKHIKPICLPITDELKEKAEQISTYFV-----------------TGWGTTE 269
            |..:.:|:|:  |....|.|....:..|.||:.:.::..|.                 |.|...:
 Frog    75 ITAVSVNQSLLAPLNLEIDPTIQQVRTEEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQ 139

  Fly   270 N----GSSSDVLLQANV 282
            |    .|:.|.:.:|.:
 Frog   140 NQKATRSNMDAMFEAYI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 16/82 (20%)
krt8.1NP_001002797.1 Keratin_2_head <63..99 CDD:374433 6/23 (26%)
Filament 102..413 CDD:365827 10/55 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.