DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and TMPRSS11A

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_872412.3 Gene:TMPRSS11A / 339967 HGNCID:27954 Length:421 Species:Homo sapiens


Alignment Length:333 Identity:91/333 - (27%)
Similarity:141/333 - (42%) Gaps:63/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EERLTEAQKAGQKVPADYASYLQKALCGEFNGVRHFCCPSANIQHNSKVMSLFKDE---NFDCGN 113
            |:|....:|            :|..|..:...:|.....::::|.|:  ||....|   ...||.
Human   130 EQRAVREKK------------IQSILNQKIRNLRALPINASSVQVNA--MSSSTGELTVQASCGK 180

  Fly   114 FL----SQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQN-DLY 173
            .:    ..|:::|.....::.||.|.|:|....:    ||..:||..:::|||||....:| ..:
Human   181 RVVPLNVNRIASGVIAPKAAWPWQASLQYDNIHQ----CGATLISNTWLVTAAHCFQKYKNPHQW 241

  Fly   174 EIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKH 238
            .:..|                .|..||::...:.:.:|||||.:....:|||:::::..|.|...
Human   242 TVSFG----------------TKINPPLMKRNVRRFIIHEKYRSAAREYDIAVVQVSSRVTFSDD 290

  Fly   239 IKPICLPITDELKEKAEQISTYFVTGWGTT-ENGSSSDVLLQANVPLQPRSACS--QAYRRAVPL 300
            |:.||||   |.....:...|..:||:|.. ..|.|.:.|.:|.|.:.....|.  |.|...:..
Human   291 IRQICLP---EASASFQPNLTVHITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDIKP 352

  Fly   301 SQLCVGGGD-LQDSCKGDSGGPLQA----PAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTN 360
            ...|.|..: :.|:|:|||||||..    ...||         .||||.| ..|||...||:||.
Human   353 GMFCAGYMEGIYDACRGDSGGPLVTRDLKDTWYL---------IGIVSWG-DNCGQKDKPGVYTQ 407

  Fly   361 VGEYVQWI 368
            |..|..||
Human   408 VTYYRNWI 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 6/37 (16%)
Tryp_SPc 121..371 CDD:238113 77/257 (30%)
TMPRSS11ANP_872412.3 SEA 49..147 CDD:279699 5/28 (18%)
Tryp_SPc 189..415 CDD:214473 76/258 (29%)
Tryp_SPc 190..418 CDD:238113 77/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.