DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG9673

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:274 Identity:72/274 - (26%)
Similarity:113/274 - (41%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHG-----LQNDLYEIRL 177
            |:..|.:|.....||.|.:||.:    ..:|.||:||..:||||||||..     :......:||
  Fly    28 RILGGEDVAQGEYPWSASVRYNK----AHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRL 88

  Fly   178 GEHRISTEEDCRQQGRKKKCAPPVVN-------VGIEKHLIHEKYDARHIMHDIALLKLNRSVPF 235
            |                      .:|       |.::..:||..|.  :.:||||:|:|:.::.|
  Fly    89 G----------------------TINQYAGGSIVNVKSVIIHPSYG--NFLHDIAILELDETLVF 129

  Fly   236 QKHIKPICLPITDELKEKAEQI-------STYFVTGWGTTENGSSSDVLLQANVPLQPRSAC--- 290
            ...|:.|.||.|.:  |:.|.:       :..:|.|||...:|::|....:||.....||.|   
  Fly   130 SDRIQDIALPPTTD--EETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCEWE 192

  Fly   291 -SQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISL 354
             ...|.     |.:|:...:.:..|:||:|..:....:.|.         |:.|.....||. ..
  Fly   193 AGYGYE-----SVVCLSRAEGEGICRGDAGAAVIDDDKVLR---------GLTSFNFGPCGS-KY 242

  Fly   355 PGLYTNVGEYVQWI 368
            |.:.|.|..|:.||
  Fly   243 PDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 71/271 (26%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/272 (26%)
Tryp_SPc 29..259 CDD:238113 71/273 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.