| Sequence 1: | NP_651543.1 | Gene: | grass / 43273 | FlyBaseID: | FBgn0039494 | Length: | 377 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_695223.2 | Gene: | Tmprss5 / 266681 | RGDID: | 628625 | Length: | 445 | Species: | Rattus norvegicus | 
| Alignment Length: | 326 | Identity: | 96/326 - (29%) | 
|---|---|---|---|
| Similarity: | 152/326 - (46%) | Gaps: | 48/326 - (14%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    54 RLTEAQKAGQKVPADYASYLQKALCGEFNGVRHFCCPSANIQHNSKVMSLFKDENFDCG-NFLSQ 117 
  Fly   118 RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQ-NDLYEIRLGEHR 181 
  Fly   182 ISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPI 246 
  Fly   247 TDELKEKAEQISTYFVTGWGTTE--NGSSSDVLLQANVPLQPRSACSQA--YRRAVPLSQLCVGG 307 
  Fly   308 GD-LQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITDT 371 
  Fly   372 M 372 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| grass | NP_651543.1 | CLIP | 32..90 | CDD:197829 | 7/35 (20%) | 
| Tryp_SPc | 121..371 | CDD:238113 | 77/255 (30%) | ||
| Tmprss5 | NP_695223.2 | SRCR_2 | 106..203 | CDD:406055 | 15/60 (25%) | 
| Tryp_SPc | 208..441 | CDD:238113 | 77/257 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||