DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Tmprss5

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:326 Identity:96/326 - (29%)
Similarity:152/326 - (46%) Gaps:48/326 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RLTEAQKAGQKVPADYASYLQKALCGEFNGVRHFCCPSANIQHNSKVMSLFKDENFDCG-NFLSQ 117
            :|..:|:..| :.|...|.:::|.....|      |||      .:::||...|   || ..|:.
  Rat   158 KLNRSQEFAQ-LSARPGSLVEEAWQPSTN------CPS------GRIVSLKCSE---CGARPLAS 206

  Fly   118 RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQ-NDLYEIRLGEHR 181
            |:..|..|.....||.|.:   ..| ||..||.::::..:::|||||::..: :.|...|:....
  Rat   207 RIVGGQAVASGRWPWQASV---MLG-SRHTCGASVLAPYWVVTAAHCMYSFRLSRLSSWRVHAGL 267

  Fly   182 ISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPI 246
            :|.....:.||..           :||.:.|..|.|::..:|:|||:|...:.|...:..:|||.
  Rat   268 VSHSAVRQHQGTM-----------VEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVSAVCLPA 321

  Fly   247 TDELKEKAEQISTYFVTGWGTTE--NGSSSDVLLQANVPLQPRSACSQA--YRRAVPLSQLCVGG 307
            .:   :...|.|..:|:|||.|:  :..|||.|....|||.....|:.:  |..|:....||.|.
  Rat   322 KE---QHFPQGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTDLCNSSCMYSGALTHRMLCAGY 383

  Fly   308 GD-LQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITDT 371
            .| ..|:|:|||||||..|:.......      |:||.| ..|.:.:.||:|..|.|::.||.||
  Rat   384 LDGRADACQGDSGGPLVCPSGDTWHLV------GVVSWG-RGCAEPNRPGVYAKVAEFLDWIHDT 441

  Fly   372 M 372
            :
  Rat   442 V 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 7/35 (20%)
Tryp_SPc 121..371 CDD:238113 77/255 (30%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 15/60 (25%)
Tryp_SPc 208..441 CDD:238113 77/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.