DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Try4

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:263 Identity:80/263 - (30%)
Similarity:126/263 - (47%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEHRI 182
            ::..||..:.:|.|:...|     ......|||::|:::::::||||    .....::|||||.|
Mouse    23 KIVGGYTCRENSVPYQVSL-----NSGYHFCGGSLINDQWVVSAAHC----YKSRIQVRLGEHNI 78

  Fly   183 STEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPIT 247
            :..|...|            .|...|.:.|..:::|.:.:||.|:||...|.....:..:.||  
Mouse    79 NVLEGNEQ------------FVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVALP-- 129

  Fly   248 DELKEKAEQISTYFVTGWGTTEN-GSSSDVLLQA-NVPLQPRSACSQAYRRAVPLSQLCVG---G 307
               ...|...:...::|||.|.: |.::..|||. :.||.|::.|..:|...:..:.:|||   |
Mouse   130 ---SSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYPGKITNNMICVGFLEG 191

  Fly   308 GDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITDTM 372
            |  :|||:||||||:....|..          ||||.| ..|.....||:||.|..||.||.:|:
Mouse   192 G--KDSCQGDSGGPVVCNGQLQ----------GIVSWG-YGCALKDNPGVYTKVCNYVDWIQNTI 243

  Fly   373 ASN 375
            |:|
Mouse   244 AAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 77/254 (30%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 75/254 (30%)
Tryp_SPc 24..242 CDD:238113 77/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.