DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and AgaP_AGAP008808

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_557970.3 Gene:AgaP_AGAP008808 / 1275666 VectorBaseID:AGAP008808 Length:574 Species:Anopheles gambiae


Alignment Length:308 Identity:82/308 - (26%)
Similarity:139/308 - (45%) Gaps:52/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CCPSANIQHNSKVMSLF-----------KDENF-DCGNFLSQRV---SNGYEVKLSSRPWMALLR 137
            ||..      .:|:.||           ::||: .||....|.|   .||.:.|....||.|.:.
Mosquito     4 CCSL------KRVLLLFGFLYFMSRACGQEENYLTCGRRKVQSVFLIHNGVDAKAGHWPWHAAIF 62

  Fly   138 YQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVV 202
            :....:..:.|||:::.:..||||:|||:..::.:...|:..|        ..|...|:.:....
Mosquito    63 HGNGRQEEYQCGGSILDQNTILTASHCVYTHKSVISAARVSVH--------VGQIHLKETSEYTQ 119

  Fly   203 NVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEK-AEQISTYFVTGWG 266
            ..|::..::|.::::....:|||||||:.::...|:::|:||...|..:|. ..:..|  :.|:|
Mosquito   120 IHGVQDIILHPEFNSNSFNNDIALLKLSTNITMTKYVQPVCLWTMDSNQEMIVGKNGT--IVGFG 182

  Fly   267 TTENGSSSDVLLQANVPLQPRSACSQAYRRA---VPLSQLCVGGGDL-QDSCKGDSGGPLQAPAQ 327
            ..|:...||.|.||.|.:.....|.::.|.|   |..|::..|.|.. ..:|.|||||.:     
Mosquito   183 LNEHDVVSDQLKQALVGVVDALTCIKSDRAAFGPVLTSEMFCGKGRTGVGACNGDSGGGM----- 242

  Fly   328 YLGEYAPKMVEFGIVS-------QGVVTCGQISLPGLYTNVGEYVQWI 368
             ..|...|....|:||       .|:  |..:.... ||:|.:|::||
Mosquito   243 -FFEVGGKWFVRGLVSFTPLRGNTGL--CDPLKYTA-YTDVAKYLEWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 1/1 (100%)
Tryp_SPc 121..371 CDD:238113 71/260 (27%)
AgaP_AGAP008808XP_557970.3 Tryp_SPc 44..288 CDD:238113 71/262 (27%)
Tryp_SPc 46..286 CDD:214473 69/258 (27%)
Tryp_SPc 324..566 CDD:304450
Tryp_SPc 330..566 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.