DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and cela1.2

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:264 Identity:76/264 - (28%)
Similarity:120/264 - (45%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGE 179
            :.:||..|...|..|.||...|:|...|...:.|.|.:|...:::.|||||..|:.  :.:.||:
Zfish    26 IEERVVGGEIAKPHSWPWQISLQYSDLGTYYYYCSGTLIRPGWVMVAAHCVEALRK--WTVALGD 88

  Fly   180 HRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIM--HDIALLKLNRSVPFQKHIKPI 242
            |.|.|.|.            |...:.:.:..||..::..::.  :|||||:|:.......:::..
Zfish    89 HDIYTHEG------------PEQYISVSEVFIHPNWNPNNVAFGYDIALLRLSIDATLSSYVQVA 141

  Fly   243 CLPITDELKEKAEQISTYFVTGWGTTENGSS-SDVLLQANVPLQPRSACSQA--YRRAVPLSQLC 304
            .||.:.|:.....   |.::||||.||.|.| |..|.||.:|:.....|||.  :..:|..:.:|
Zfish   142 TLPSSGEILPYGH---TCYITGWGYTETGGSLSAQLKQAYMPVVDYETCSQKDWWGSSVKETMIC 203

  Fly   305 VGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWIT 369
            .||.....:|.||||.||.  ..:.|:|....|...:..:|   |.....|..:|.|..|:.||.
Zfish   204 AGGTTSMSACHGDSGSPLN--CLFNGKYVVHGVTSFVSPEG---CNTYKKPTGFTRVSAYINWIN 263

  Fly   370 DTMA 373
            ..::
Zfish   264 QIIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 74/254 (29%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 74/254 (29%)
Tryp_SPc 30..265 CDD:238113 75/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.