DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc4

DIOPT Version :10

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001013141.2 Gene:Zdhhc4 / 304291 RGDID:1308389 Length:343 Species:Rattus norvegicus


Alignment Length:122 Identity:41/122 - (33%)
Similarity:55/122 - (45%) Gaps:25/122 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LVTYFLLIVGNWLLLNVVFHYVMAVITPAGHPPEGVSLVEAV-----------SMCGKCIAPKPP 148
            |:.|.||.|      |:||..:.....|.......|||:..|           |.|..|...||.
  Rat   102 LLPYVLLSV------NLVFFTLTCSTNPGTITKTNVSLLLQVYEFDEVMFPKNSRCSTCDLRKPA 160

  Fly   149 RTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYM--------TYTTLGCLFLI 197
            |:.||.:|:||:.:.||||.|:|||:|..|..||.:|:        |...|...||:
  Rat   161 RSKHCRVCDRCVHRFDHHCVWVNNCIGAWNTGYFLIYLLTLTASAATIAILSAAFLL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 DHHC 139..>201 CDD:396215 27/67 (40%)
Zdhhc4NP_001013141.2 Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.