DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG34316

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster

Alignment Length:246 Identity:43/247 (17%)
Similarity:92/247 (37%) Gaps:50/247 (20%)


  Fly     9 LLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMR 73
            :|:|.|..|.||               ||.:.    ...:|.|..::...:|.:  ....:||::
  Fly    16 ILYACLSPAACV---------------YEAKI----LAFLQEFRMRMCHPIPNL--GLPALDPLQ 59

  Fly    74 QEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVS-----KKDFSWLTKIYLPQMRIDGHY 133
            ......:.:|..:...:.::.:..:.|.....:....:|     |...:    :.||.......|
  Fly    60 LGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPVPGLKNTIN----VTLPLTYFKSLY 120

  Fly   134 KMVGRI-LLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNL 197
            ...|.: .::.|.|:|.....|.:..||::.:.|     ..:...::|:::::.:|.:....|||
  Fly   121 TAKGSLAYILNLAGDGNAETSITNFSILISFRLR-----SVSPLAISSLQIELRLGGLWINFDNL 180

  Fly   198 FNGHSKEVEDSTNQFFN--------DNWKDVFEALRPLVVETVERTLLDLL 240
            ..      ||..|.|.:        :...||::..:..||..|:..:.:.|
  Fly   181 ME------EDRINDFIHALVNEMGVELLGDVWDYEQGTVVSKVQAAVNNFL 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 35/216 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406925
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.