DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG14259

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster

Alignment Length:266 Identity:164/267 (61%)
Similarity:211/267 (79%) Gaps:2/267 (1%)


  Fly     3 LIGLLMLLHAGLQGA--QCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEES 65
            |:.:|.|....:..:  ..||:|:|||:::.||:||||.||||||.|||..::||..|:||:.|.
  Fly    17 LLAILCLNEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLER 81

  Fly    66 FGPIDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRID 130
            |||.||||...:||||||::|||:.|||||::::||....:|||:||||||||.||||||:||:|
  Fly    82 FGPFDPMRVRDIVFKQDNNEVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLD 146

  Fly   131 GHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLD 195
            |.|:|.|||||:||.|:|||.:||||||||:.||.|||||||:||.|||:|:|::::.||||.||
  Fly   147 GRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLD 211

  Fly   196 NLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFVEDIPTSL 260
            |||||.|||||.|||:|||:||:|.:|||:||:|||||..|.|::...|.|.||:||||||||..
  Fly   212 NLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFVEDIPTPQ 276

  Fly   261 TLYGRK 266
            .|||.|
  Fly   277 QLYGPK 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG14259NP_651532.1 JHBP 32..269 CDD:284096 151/237 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1396559
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.