DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG14258

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster

Alignment Length:254 Identity:84/255 (33%)
Similarity:145/255 (57%) Gaps:8/255 (3%)


  Fly     4 IGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGP 68
            :.::.:|.:.::||:.:|   |||.::..|.:.:|.|..|.|::.|:|..|...|:|.. .:.|.
  Fly     9 LSIVAVLLSAVEGAKYLA---EKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGY-NAVGS 69

  Fly    69 IDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDGHY 133
            .||...:::.|.||.|....::|:|.::.:.|.|:.|:.||......:...|.|.:|::|.:..|
  Fly    70 FDPFYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSWDPNHYVARTLISVPKLRFNFDY 134

  Fly   134 KMVGRILLVPLQGNGKIVMEIDDLDILMTTKTR-LYEKGGYTFYNVTSVKVKV-DVGKVRTRLDN 196
            |:.|.:..:.|.|:||...|.::..:|:....: |....|| |.:|.||||.. ::.:.|.:|:|
  Fly   135 KVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGY-FADVQSVKVNFREIKQFRIKLEN 198

  Fly   197 LFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFVED 255
            ||.| :|::||:.:..||:||:|.||.|||.|.:||...|||...|||...||::.::|
  Fly   199 LFGG-NKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYVPATYLIKD 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG14258NP_651531.1 JHBP 13..255 CDD:284096 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1396686
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.