DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG11854

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster

Alignment Length:254 Identity:62/255 (24%)
Similarity:120/255 (47%) Gaps:20/255 (8%)


  Fly     2 LLIGLLMLLHAGLQGAQCVAFY---TEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVK-GVPEI 62
            |.:.|::|.       .|.:.|   ::.||.||.|.|.:.:   |....:...:....| |:.|:
  Fly     3 LTLALVLLF-------GCASTYGHASDFPSGIERCAIMDEQ---CLEDRVNFVLRNYAKSGIKEL 57

  Fly    63 EESFGPIDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYL--P 125
              ...|:||:..::....::......:..:..:|.|.|..:.:.|......:|.|...::.:  |
  Fly    58 --GLIPLDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVMEVP 120

  Fly   126 QMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGY-TFYNVTSVKVKVDVGK 189
            ::.:.|.|.:.||||::|:.|||...:.:....:....|.:...||.: |:..|.::||::|...
  Fly   121 EIGVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSH 185

  Fly   190 VRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFP 248
            |..:|:||||| .|::.::.:...|:||||:|..|:|.:.|........::.:.|...|
  Fly   186 VTYQLENLFNG-QKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLP 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG11854NP_651358.4 JHBP 21..249 CDD:214779 57/230 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1397470
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.