DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG11852

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651357.1 Gene:CG11852 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster

Alignment Length:273 Identity:70/274 (26%)
Similarity:121/274 (44%) Gaps:47/274 (17%)


  Fly     7 LMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMN---QLVK-----GVPEIE 63
            :|||..|     |||.:.   ..:.....:.||..:|........:|   .|::     |.|  .
  Fly     1 MMLLQLG-----CVALFC---CLVSGASNFPPELPRCHMGDTSCIINVSHMLIRQHARTGYP--S 55

  Fly    64 ESFGPIDPMRQEQLVFKQDNSDVAT----LSANLTDMLIRGFGKMLI-------KESKVSKKDFS 117
            ..|..::|.    |:.:.|.||..|    |..|..|:.:.|...:..       .:...||    
  Fly    56 AGFPQVEPF----LIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSK---- 112

  Fly   118 WLTKIY--LPQMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTS 180
              .::|  .|::.:.|.|...||||::|::|:|...:.:.:....:..|....::.|.|:.:|..
  Fly   113 --FEMYGSFPKIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDK 175

  Fly   181 VKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRP---LVVETVERTLLDLLHK 242
            :||.|:..|:..||:||||| .:.:..:.|||.||||.:|:..|.|   :.:..:.:::|..|.|
  Fly   176 LKVLVEPQKMNIRLENLFNG-DQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFK 239

  Fly   243 TFALFPASFFVED 255
            .||.  ...|:|:
  Fly   240 RFAY--EDLFLEN 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG11852NP_651357.1 JHBP 9..248 CDD:284096 64/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1398182
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.