DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG13618

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster

Alignment Length:260 Identity:71/261 (27%)
Similarity:112/261 (43%) Gaps:39/261 (15%)


  Fly     6 LLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFG--P 68
            |::||.|.:.....|....|.|.....|| .:..|.||...::...:.||..|    ...||  |
  Fly     8 LMLLLIAAVAQELTVTAAQELPEGFPKCK-RDANFDKCLVDAVNVAIQQLKAG----NREFGIPP 67

  Fly    69 IDPMRQEQLVFKQDNSDV----ATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRI 129
            ::|:..::||....|:.:    |..:..:.||         |..||:.:........:.:...|.
  Fly    68 LEPLTVKKLVIDAGNAPINLRQALKNVKVHDM---------ISTSKIQRYRTDLDKHLIICDSRT 123

  Fly   130 D-----GHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKT--RL----YEKGGYTFYNVTSVKV 183
            |     |.|:|.|||||:|:.|:||..:      .|:.||.  ||    :||.|..:..:...:|
  Fly   124 DRIEMIGDYEMSGRILLLPITGHGKANV------TLINTKIEHRLIGEPFEKDGVKYMRLKDYRV 182

  Fly   184 KVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFP 248
            ..|..:|....:||||  .|.:.|..|:|.|:||:.||..|:....::......:|.:|.|...|
  Fly   183 SFDPKRVYMNFENLFN--DKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVP 245

  Fly   249  248
              Fly   246  245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG13618NP_651265.1 JHBP 13..251 CDD:284096 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1398844
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.