DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG15497

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster

Alignment Length:248 Identity:47/249 (19%)
Similarity:91/249 (37%) Gaps:44/249 (18%)


  Fly    24 TEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMRQEQLVFKQDNSDVAT 88
            |:....:..|...:.:|.:|..:...........|||:.  :..|.||.....:..::..|    
  Fly    37 TDLKHLLGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDY--NIKPFDPHHCSYVELRRGES---- 95

  Fly    89 LSANLTDMLIRGFGKMLIKESKVSKKDFSW----LTKI-------------YLPQMRIDGHYKMV 136
                      :|.|...:....||  ::.|    :||.             |.|...::|.|:..
  Fly    96 ----------QGLGSFRLILRNVS--EYGWARSEVTKFHADPEDQRIVYTQYFPDKSLEGEYEFA 148

  Fly   137 GRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVD-VGKVRTRLDNLFNG 200
            .::|...:...|...:.:  .|...||..|.....|    ::..|.|:|| :|.:...::||..|
  Fly   149 AKMLGTEMNRKGHWNLTL--YDYSQTTSVRRIGGPG----SLIKVHVEVDRIGGMELHIENLLQG 207

  Fly   201 HSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFV 253
              :.:....:...|..|:.....::|::.|.|.....|:.:::|..||...|:
  Fly   208 --QPLNQLADGVINSMWQLGLPFIKPMINELVSTAFTDIFNESFRHFPLEKFL 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG15497NP_650976.1 JHBP 26..258 CDD:284096 47/247 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406061
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.