DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG17279

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster

Alignment Length:228 Identity:53/229 (23%)
Similarity:106/229 (46%) Gaps:15/229 (7%)


  Fly    27 PSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMRQEQLVFKQDNSD-VATLS 90
            |..||.|:..:   :.|...::...:....||:|.|  ....:|.:..|.:|..:...| .:|..
  Fly    20 PPEIEKCRAGD---SICIAETVTRILRLYPKGLPSI--GLVALDSIGFEDVVVSRLEPDGSSTFD 79

  Fly    91 ANLTDMLIRGFGKMLIKESKVSKKDFSWLTKI--YLPQMRIDGHYKMVGRILLVPLQGNGKIVME 153
            ....::.:.||....:.|:|....|...:.::  ::|.::::|.|:|.|.:|.:|:.|.|:..:|
  Fly    80 LKFPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMRGSLLTMPIHGKGQAKVE 144

  Fly   154 IDDLDILMTTKTRLYE---KGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFND 215
            |.:..:  ..|.|:.|   ..|..:..::.||..:||..:...|:||||  :.|:.|:.|...|.
  Fly   145 IRECRV--RCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFN--NPEMSDAMNVVANT 205

  Fly   216 NWKDVFEALRPLVVETVERTLLDLLHKTFALFP 248
            .|.:::..||..:...|::.:..:|.:.....|
  Fly   206 KWLEIWHNLRRGITSAVDQLVESILQRVANKLP 238



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1397927
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.