DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG7079

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster

Alignment Length:242 Identity:57/243 (23%)
Similarity:96/243 (40%) Gaps:23/243 (9%)


  Fly    16 GAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMR-QEQLVF 79
            |.||    .:.|:.::.|...:   .||...|..|.:....||:||::  ..|.:.:. ::.|:.
  Fly    16 GLQC----QKLPAKVKKCHFGD---GKCLVESANALLRDFPKGIPEVD--LKPFNVLSVRDWLLV 71

  Fly    80 KQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKI----YLPQMRIDGHYKMVGRIL 140
            .......|....||.:.:..||....|.|.:...|| ...|||    .:|::...|.|...||:|
  Fly    72 NDSQVGGAWYYFNLINQINYGFENTTITEIRGFDKD-PTTTKIEIHGKIPRLVYKGDYVAKGRML 135

  Fly   141 -LVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKE 204
             .|.:...|....:..:...::|.|.|:..:....:..:..:...:.:.:....|||.|    .:
  Fly   136 WFVDIHSQGTSESDFLNFQFVLTLKVRVEYRNNKRYLKIYELVPNIRLDRWIMWLDNFF----PD 196

  Fly   205 VEDST---NQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFP 248
            .||.|   |..||.||.:.:..|.|.::...|...|.|....|...|
  Fly   197 NEDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVP 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 54/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1397693
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.