DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG31189

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster

Alignment Length:227 Identity:52/228 (23%)
Similarity:101/228 (44%) Gaps:20/228 (9%)


  Fly    27 PSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMR-QEQLVFKQDNSDVATLS 90
            |..:|.|...:   :.|..|||.|.:....||:|||  ...|:|... .:.::.:..:.....:.
  Fly    24 PEDVEKCHFGD---STCLVRSINALIKHYPKGIPEI--GLPPLDAYNFPDSVIMESPSRGPIWMD 83

  Fly    91 ANLTDMLIRGFGKMLIKE-----SKVSKKDFSWLTKIYLPQMRIDGHYKMVGRILLVPLQGNGKI 150
            ..:.|.:.:||....|..     .:.::|..  :.|:.||::..:..|.|.||:||......|::
  Fly    84 FRMRDNVNKGFNNATITHVEGFLYEPNQKQI--VLKVRLPRLVHEATYDMSGRVLLFFFNTTGRL 146

  Fly   151 VMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDST---NQF 212
            :.:..:..|.:|.|..:..:....:..:.::...:|:.:....||.|:    ||..|.|   |:.
  Fly   147 ISDFQNFRITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLY----KENTDVTIFMNKL 207

  Fly   213 FNDNWKDVFEALRPLVVETVERTLLDLLHKTF 244
            ||:||.:.:..|:|.:|:........||::.|
  Fly   208 FNENWVEFWNDLQPGLVKAFTNAFTVLLNRVF 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG31189NP_732580.3 JHBP 9..249 CDD:284096 52/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1398054
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.