DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG10264

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster

Alignment Length:236 Identity:68/237 (29%)
Similarity:119/237 (50%) Gaps:16/237 (7%)


  Fly    25 EKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEI-EESFGPIDPMRQEQLVFKQDNSDVAT 88
            |:||::::||...|...||..:..:.....|..|:||| .:||   :|:..:|:...:.:.:: .
  Fly    43 ERPSWLQTCKRSNPNEDKCFRQLFEGCFPALAAGIPEIGVKSF---EPLNIDQVSVSKGSGNL-V 103

  Fly    89 LSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDGHYKMVGRILLVPLQGNGKIVME 153
            ||....|::|||.....::.:.:..:......::.||::||...|.:.|.|||:||.|:|.:.|.
  Fly   104 LSGGFQDLVIRGPSNATVRRASLDLERRLLNFELELPRLRIRAKYNLKGNILLLPLVGSGDVAMA 168

  Fly   154 IDDLDILMTTKTRLYE--KGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDN 216
            :.::...:.|:..|..  :.|....::..:||..|||.:|..|.||||| ::.:..|.|.|.|.|
  Fly   169 LKNVHTTVYTRISLRNETRTGDEIIHIDEMKVGFDVGAMRIHLKNLFNG-NEILAASINSFLNQN 232

  Fly   217 WKDVFEALRPLVVETVERTLLDLLH----KTFALFPASFFV 253
            .|:|...|||    .:|..|.|:.|    ..|:..|...::
  Fly   233 GKEVIAELRP----DLELGLADIFHGLWNNVFSKMPTKLWL 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG10264NP_650518.1 JHBP 42..270 CDD:214779 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1398879
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.