DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG1124

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster

Alignment Length:242 Identity:54/243 (22%)
Similarity:107/243 (44%) Gaps:26/243 (11%)


  Fly    25 EKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMRQEQLVFKQDNSDVATL 89
            |.|.||:.|...:|:...|...:|:.....|..|:|:|:  ...::|       ||.|     ||
  Fly    20 ETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQ--LPSVEP-------FKMD-----TL 70

  Fly    90 SANLTD-----------MLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDGHYKMVGRILLVP 143
            :..||:           |...|.....:...|:|:....:..||.:|:::|:..|...|.:|::|
  Fly    71 ALQLTEGPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIVMPKLKIEAKYTSSGVLLILP 135

  Fly   144 LQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDS 208
            ..|.|......:.:...:|.||.::...|..:.::.::.:.:||..|:..:...|| :::.:.::
  Fly   136 ASGGGDFHANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFN-NNRILLEA 199

  Fly   209 TNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFVED 255
            ||.|..:|.:.|.||::..:.:.:......|.::.....|...|..|
  Fly   200 TNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFYVD 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG1124NP_649509.1 JHBP 6..244 CDD:284096 53/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1401873
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.