DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG1124

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:242 Identity:54/242 - (22%)
Similarity:107/242 - (44%) Gaps:26/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMRQEQLVFKQDNSDVATL 89
            |.|.||:.|...:|:...|...:|:.....|..|:|:|:  ...::|       ||.|     ||
  Fly    20 ETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQ--LPSVEP-------FKMD-----TL 70

  Fly    90 SANLTD-----------MLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDGHYKMVGRILLVP 143
            :..||:           |...|.....:...|:|:....:..||.:|:::|:..|...|.:|::|
  Fly    71 ALQLTEGPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIVMPKLKIEAKYTSSGVLLILP 135

  Fly   144 LQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDS 208
            ..|.|......:.:...:|.||.::...|..:.::.::.:.:||..|:..:...|| :::.:.::
  Fly   136 ASGGGDFHANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFN-NNRILLEA 199

  Fly   209 TNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFVED 255
            ||.|..:|.:.|.||::..:.:.:......|.::.....|...|..|
  Fly   200 TNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFYVD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 53/239 (22%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 52/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.