DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG2016

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001262270.1 Gene:CG2016 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster

Alignment Length:264 Identity:59/265 (22%)
Similarity:116/265 (44%) Gaps:38/265 (14%)


  Fly     1 MLLIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEES 65
            |:.|.|:.:|.:        .|..|:|.|::.|...|.:..:|...|....::.|.|||||::  
  Fly     5 MVFIVLVAVLGS--------TFAQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELD-- 59

  Fly    66 FGPIDPMRQEQ--LVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWL---TKIYLP 125
            ...|:|:..::  :|..........|..|     |:.:|...|..:.: :.|...|   ....:|
  Fly    60 IYEIEPVMIDEIGIVLGSGPDGYRALFRN-----IQAYGVSNITVTNI-RSDLDSLQFQLTCEIP 118

  Fly   126 QMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKG-------GYTFYNVTSVKV 183
            ::|:...|:..|.::||...|.|....|.:.:      |.::|.|.       |.|:....|||:
  Fly   119 RIRVKAQYRSTGVLILVKASGAGDYWGEYEGV------KAKIYFKAVANEGPDGRTYLTTDSVKM 177

  Fly   184 KVDVGKVRTRLDNLFNGHS----KEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTF 244
            ..:|.:::..:||:.||::    ...|.:.|.|.|.|.:::.:.::|.:...:...:.:.:.:.|
  Fly   178 DFNVKEIQMGVDNIANGNTVILLSSTEAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIF 242

  Fly   245 ALFP 248
            |..|
  Fly   243 AKIP 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 58/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1401901
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.