DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG14661

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster

Alignment Length:255 Identity:66/256 (26%)
Similarity:114/256 (45%) Gaps:27/256 (11%)


  Fly     2 LLIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESF 66
            |||..:..:.||           ..|.||:.|...:||.:||...|:......|.||:.|:  :.
  Fly    10 LLICFVACISAG-----------NMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKEL--NV 61

  Fly    67 GPIDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDG 131
            .|::|:....|.. .|.|...|:.|...::|  |.....|.:.:.|.::..:..::.||.:..||
  Fly    62 PPLEPLYIGDLSI-LDGSAGLTVKAKKLNIL--GASNFEITKLRASTQNRRFDFELILPHLHGDG 123

  Fly   132 HYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDN 196
            .|::.|.||.:|::|||.......:....:..:..:.......:.:|....:|:..||...:|:|
  Fly   124 LYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLEN 188

  Fly   197 LFNGHSKEVEDSTNQFFNDNWKDVF--EALRPLVVETVERTLLDLLHK-----TFA-LFP 248
            |||| .|.:.|..|...|.|: :||  :.:.| :...:|...|.:..|     |:: |||
  Fly   189 LFNG-DKVLGDVINDTINQNF-EVFTNDLIAP-IARALEAKFLVITTKILENFTYSELFP 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 65/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1400420
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.