DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG14457

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster

Alignment Length:263 Identity:113/264 (43%)
Similarity:165/264 (63%) Gaps:3/264 (1%)


  Fly     3 LIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFG 67
            ||.||:.....|..|: ..|..|.|.||:.|:|.:.:|..|||.|||...::|..|:|.: .|..
  Fly     6 LIVLLVTFTTCLVRAE-DGFLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIPGL-TSIR 68

  Fly    68 PIDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDGH 132
            ..||....::...|.||:...|...|.::.|.|||...:.:|:|.|||:||.|...||:|::...
  Fly    69 SFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKLQAD 133

  Fly   133 YKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNL 197
            |.:.|||||:||.|.|::.::.:::.:.|.||||||.|||:||||||::.|...:..:::...||
  Fly   134 YSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYFSNL 198

  Fly   198 FNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFVEDIPTSLTL 262
            ||| :|::|||||:||||||:.:.:||..::.:|:|..|||:|.|.|...||:|||.||||...|
  Fly   199 FNG-NKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFHFIPANFFVSDIPTPEQL 262

  Fly   263 YGR 265
            |||
  Fly   263 YGR 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 104/250 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1396596
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.