DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG33680

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster

Alignment Length:256 Identity:51/257 (20%)
Similarity:87/257 (34%) Gaps:64/257 (25%)


  Fly    30 IESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESF--GPIDPM----------RQEQLVFKQD 82
            |..|...||...:|...:.......||.|  .:.:.|  .|::|:          .|.|.|||  
  Fly    35 ITPCARNEPLLERCIINAAYQIRPLLVHG--NLGDGFPTSPLEPLSLDNIELKLSSQFQAVFK-- 95

  Fly    83 NSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDGHYKMVGRILLVPLQGN 147
              |:.....|.|                                    |.|.:...:||..::|.
  Fly    96 --DLEANGGNYT------------------------------------GKYSLHLNLLLPDIKGK 122

  Fly   148 GKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQF 212
            |.:....::....:..:...|.:.|..:...:.:...:|....:.:|.|||:| .:.:.|..|..
  Fly   123 GNMQGYCENAKAFVKIRGSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSG-DRFLGDVGNSL 186

  Fly   213 FNDNWKDVFEALRPLVVETVERTLLDLLHKTFA------LF-PASFFVEDI--PTSLTLYG 264
            .|:|.:...:.:.|.:...:.:..||:..|..|      :| |...||..|  |..|.|.|
  Fly   187 INNNQELYLKDIAPSLEHGLSKHFLDVADKILASATFDEMFPPGKTFVSPITHPPRLPLSG 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 43/236 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1401184
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.