DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG16820

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster

Alignment Length:231 Identity:48/232 (21%)
Similarity:99/232 (43%) Gaps:15/232 (6%)


  Fly    30 IESCKIYEPEFTKCSTRSIQAFMNQL-VKGVPEIEESFGPIDPMRQEQLVFKQDNSDVATLSANL 93
            :..|.:..|:..:|....||:|..:| .:||||.  :...|||...::.:|:..|..:.. ...:
  Fly    85 VTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEF--NMDSIDPYFYKRGIFRYTNDGIQG-GLLI 146

  Fly    94 TDMLIRGFGKMLIKESKVSKKDFSWLTK--IYLPQMRIDGHYK---MVGRILLVPLQGNGKIVME 153
            .:|.|.|..::.:.....:..|..::.|  :.|||::..||:|   ..|.:.|||   .|...:.
  Fly   147 KNMEIYGISQLQVNSVAANFTDNGFIIKLGVELPQLKAGGHFKADVKFGGLRLVP---KGPFNIT 208

  Fly   154 IDDLDILMTTKTRLYE-KGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNW 217
            ||::...:.|...:.: ..|....::..:...|::|..:...:.:|:  .:.:........|:|.
  Fly   209 IDNIKATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFS--DRNLNAMILNLVNENL 271

  Fly   218 KDVFEALRPLVVETVERTLLDLLHKTFALFPASFFV 253
            .::.....|...|.....|:..:::.||..|...|:
  Fly   272 PEITRVGIPATREQWAPILIAHINEFFAKVPIEKFL 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG16820NP_609627.1 JHBP 79..308 CDD:214779 48/232 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1404664
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.