DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG5867

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster


Alignment Length:267 Identity:60/267 - (22%)
Similarity:116/267 - (43%) Gaps:38/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MLLHAGLQGAQCVAFYTEKPSY-----------IESCKIYEPEFTKCSTRSIQAFMNQLVKGVPE 61
            ::|.|||    |:|...|.|..           |.:|:..:...::|..:.:|....::..|:.|
  Fly    10 LILMAGL----CLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPRMKYGISE 70

  Fly    62 IEESFGPIDPMRQEQLVFKQDNSDVATLSA------NLTDMLIRGFGKMLIKESKVSKKDFSWLT 120
            :  :..|:||       |:...|..:..|.      ::.:::|.|..:.::.:.....||.....
  Fly    71 L--NIPPLDP-------FEMGKSSYSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRM 126

  Fly   121 KI--YLPQMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKT--RLYEKGGYTFYNVTSV 181
            :|  ::|||.::|.||  ..|.|..|:.|.|....|...|:.|..:.  .|||:.|:|:..:|.:
  Fly   127 EILSHVPQMFVEGLYK--ADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTKL 189

  Fly   182 KVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFAL 246
            :.:..||.::...:.|.  ....:.|....|.|..|:.:::|:.|..::|.:..:|...:..||.
  Fly   190 ETEPKVGDLKFYANGLV--PDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAA 252

  Fly   247 FPASFFV 253
            .|....|
  Fly   253 LPFDMLV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 54/251 (22%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 52/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.