DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG3246

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster

Alignment Length:292 Identity:53/293 (18%)
Similarity:110/293 (38%) Gaps:85/293 (29%)


  Fly     6 LLMLLHAGLQGAQCVAFYTEKPSYI---------ESCKIYEPEFTKCSTRSIQA--------FMN 53
            |::::..||..:.|...::::|...         ::.||.|      |..||.|        |..
  Fly     4 LIVVVLVGLMASGCHIVHSQEPGDAVEQEASESDDALKIKE------SQASIAAQVEAMLVHFQQ 62

  Fly    54 QLVKGVPEIEESFGPI-DPMRQEQLVFKQDNSDVATLSANLTDMLIRGFG--KMLIKESKVSKKD 115
            :..:|:|.:     |: ||:       :..|...:...|||....::.:|  |..|.:..:..|:
  Fly    63 EDPQGLPGV-----PVPDPL-------EVPNVKKSMGMANLDMKQVKAYGLSKFRIDKMNLDLKE 115

  Fly   116 FSWLTKIYLPQMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTS 180
            ..:...:.|.||.:.|.|.:....    .:.||...:.:.:: ....|.....|:.|    .:.:
  Fly   116 MRFNGGLQLDQMLVKGQYTLSSFF----SKANGPFTVVLKNV-YAEATAFLAVERDG----QLAT 171

  Fly   181 VKVKVDV------------GKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVE 233
            .::|:|:            |.|.:...::.||       :.|.        ||:|::|.:::..:
  Fly   172 DRIKIDITFSDMTMDFQNLGLVGSVFQSVVNG-------APNL--------VFDAMKPFMLQEAD 221

  Fly   234 RTLLD----LLHKTFALFPASFFVEDIPTSLT 261
            :.|..    ::.||..       ...:|.|:|
  Fly   222 KKLRSEINVMIQKTLG-------ERRLPNSIT 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG3246NP_608781.2 JHBP 31..246 CDD:214779 47/264 (18%)
Grp7_allergen 260..418 CDD:293589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1403132
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.