DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG31207

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster

Alignment Length:229 Identity:52/230 (23%)
Similarity:101/230 (44%) Gaps:17/230 (7%)


  Fly     2 LLIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESF 66
            :::.:|:.:...||| |.:      |..|:.|:..:   :||...|:.|.:....||:|.|  ..
  Fly     5 IIVLVLLQIIGSLQG-QIL------PKEIKKCRFGD---SKCIVNSMNAIIKNYPKGIPAI--GL 57

  Fly    67 GPIDPMRQEQLVFKQDNSDVA-TLSANLTDMLIRGFGKMLI-KESKVSKKDFSWLTKIY--LPQM 127
            .|||.:......|..|....| .|:.:|.:.:..||....| |.|...:...|.|.:|:  :|.:
  Fly    58 KPIDVVDIRDSKFWNDAMVGAFWLNFDLFNQVNYGFENTTITKVSGFDENPTSSLIEIHGRIPSL 122

  Fly   128 RIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRT 192
            ...|.|..:||:.:|.:...|:.:.:..:...::..|..:..:....:..:..:...|.:.:...
  Fly   123 IHKGDYFSMGRVWIVQMNSTGESLSDFQNFRFVLKLKVIMEYRNNKRYLKIYELTPFVTMDRWVF 187

  Fly   193 RLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRP 226
            .|||.|..:: ::..:.||.||.:|.:.:..|.|
  Fly   188 WLDNFFESNT-DMTIAINQVFNLHWVEFWNELEP 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG31207NP_732581.1 JHBP 7..248 CDD:284096 52/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1397812
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.