DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17189 and CG2650

Sequence 1:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:CG2650 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster

Alignment Length:270 Identity:60/271 (22%)
Similarity:113/271 (42%) Gaps:37/271 (14%)


  Fly     1 MLLIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEES 65
            ::.:|||..:...:..::  .|    ||.::.||:.:   ..|.....|.|......|:|  |..
  Fly    10 LVWVGLLSWVSCRVDASE--GF----PSPLKRCKLQD---ESCLLAQAQTFFQAFKNGIP--ERQ 63

  Fly    66 FGPIDPM-----------RQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWL 119
            ...::|:           ..|.:.||...||     |.|.::.    ..|::|..|...||.:..
  Fly    64 VAALEPIALGTMFIESGGHSESIKFKLTMSD-----AKLYNLA----NSMMVKSLKGFTKDLTRP 119

  Fly   120 TKIYL----PQMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDI-LMTTKTRLYEKGGYTFYNVT 179
            .|:.|    |::.:...|.:.|::|::|:...|.:.:.::|:.. :..|...:....|:|:.|:|
  Fly   120 LKLTLLLDNPELEVRAKYDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGHTYLNIT 184

  Fly   180 SVKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTF 244
            ..|....:......|.|||| .:||:.|||.:..|..|..:...::|.:.|...:....::...:
  Fly   185 DYKTATKIKGGHFDLSNLFN-DNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLW 248

  Fly   245 ALFPASFFVE 254
            |..|...|.|
  Fly   249 ANIPYDEFFE 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 None
CG2650NP_570016.1 JHBP 29..258 CDD:214779 56/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1398394
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.