DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and ccbe1

DIOPT Version :10

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001157395.1 Gene:ccbe1 / 555629 ZFINID:ZDB-GENE-090506-7 Length:401 Species:Danio rerio


Alignment Length:240 Identity:50/240 - (20%)
Similarity:72/240 - (30%) Gaps:100/240 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VSAQICTVNVTRNIK-------GTAVNVQTRDCCKGYKKVRSSALRCL---------AQCKVNCG 64
            |..::|:.:.....|       |.......:.||:|:|.|..   :|:         |.|:..|.
Zfish    34 VDREVCSESKIATTKYPCVKSTGEVTTCYRKKCCEGFKFVLG---QCIPEDYDVCAGAPCEQQCT 95

  Fly    65 SGFCTKPNVCTCKKGYVNLNNDPSNRCVPYCKGCSRGTCQSPGRCICSARHLLDKTTNNCIPQCA 129
            ..|...  ||||..||........||..|||..                   :|:..||....|:
Zfish    96 DHFGRV--VCTCYDGYRYDRERHRNREKPYCLD-------------------IDECANNNETVCS 139

  Fly   130 SGCPNGTCITPNNCSCNKGYKLNPTTQVCLPTCKDNCAAVNGFCAAPNRCECNPGFIPKPKSKSF 194
            ..|.|    ||.:                                  .||:|:.||..:...|: 
Zfish   140 QMCVN----TPGS----------------------------------YRCDCHSGFYLEDDGKT- 165

  Fly   195 ECQPKCKNGCSNGVCRAPDKCECNKFYEKD----IDGNCVPICEN 235
                     |:.|. |||       .:||.    .:|.|...||:
Zfish   166 ---------CTKGE-RAP-------LFEKSDNVMKEGTCSATCED 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
ccbe1NP_001157395.1 FXa_inhibition 130..166 CDD:464251 13/83 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..401
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.