DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and Tnfaip6

DIOPT Version :10

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_033424.1 Gene:Tnfaip6 / 21930 MGIID:1195266 Length:275 Species:Mus musculus


Alignment Length:81 Identity:22/81 - (27%)
Similarity:32/81 - (39%) Gaps:12/81 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   900 LCVSPDFCKCDDGYIFVEESKSCQLDKELLGDY-------SDCDKNCRNGTCVE--GICTCSKQ- 954
            :|.:....|...||..|:...:|...|..:.||       ...|..|.|....|  |:.|..|: 
Mouse    81 VCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKRI 145

  Fly   955 YKL--HRNEDDNNLIC 968
            :|.  ..||.|:|.:|
Mouse   146 FKSPGFPNEYDDNQVC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
Tnfaip6NP_033424.1 Link_domain_TSG_6_like 36..128 CDD:239592 10/46 (22%)
CUB 135..244 CDD:395345 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..275
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.