DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and dsl-6

DIOPT Version :10

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_502148.2 Gene:dsl-6 / 178063 WormBaseID:WBGene00001108 Length:303 Species:Caenorhabditis elegans


Alignment Length:115 Identity:31/115 - (26%)
Similarity:46/115 - (40%) Gaps:37/115 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KCECNKFYEKDIDGNCVPICEN--GCVNG-NCTAPDVCQCLTGYTKIGHNVCLAVCPEGCQNGVC 275
            :|:.|.|.||     |...|:|  ..::| .|....|..||..:|..|   |:.:          
 Worm   120 ECDENWFGEK-----CDVFCDNIEQRLHGKRCNYRGVPSCLNMFTGAG---CMKM---------- 166

  Fly   276 VAPNECSCNAGYTKLEGVC-----TPVCKDGCVNGFCASPEKCSCNDGYE 320
            :.|.:|||     |..|.|     ||:|:  |..||...    :|.:.:|
 Worm   167 ITPMDCSC-----KNNGKCVDSAETPICE--CTRGFKGD----TCEEMHE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
dsl-6NP_502148.2 DSL 101..163 CDD:128366 15/50 (30%)
EGF_CA <174..201 CDD:238011 10/37 (27%)

Return to query results.
Submit another query.