DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and dsl-2

DIOPT Version :10

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_500052.1 Gene:dsl-2 / 176938 WormBaseID:WBGene00001104 Length:322 Species:Caenorhabditis elegans


Alignment Length:114 Identity:29/114 - (25%)
Similarity:43/114 - (37%) Gaps:38/114 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   810 CDEGYSRETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSPVCSGGCKNGFCVAPGKC 874
            |||..:...|..|......||..|||..    :|:     .::::||.:|:  |:|.   ||...
 Worm   135 CDEDAAHLVGMRCNKKGVMGCNEGFCGP----NCD-----QTKSQCSMMCA--CEND---APCYS 185

  Fly   875 SCDEGYSKETEISCAPFCKDGCVNGLCVSPDFCKCDDGYIFVEESKSCQ 923
            |.|...|:|..                    :|:|..|:    |.|.||
 Worm   186 STDPRTSREYV--------------------YCECLTGF----EGKYCQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
dsl-2NP_500052.1 DSL 102..164 CDD:128366 10/32 (31%)

Return to query results.
Submit another query.