DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr78Cb

DIOPT Version :8

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001262144.1 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster

Alignment Length:85 Identity:21/86 (24%)
Similarity:37/86 (43%) Gaps:14/86 (16%)


  Fly    62 QINKHNEDGSYTYGYEGADGSFKIETKLATG--EVKGKYGYVDETGKVRVVEYGANKYGFQPSGE 124
            :::..:::|.:.|.::.::|   |:.:.|..  |..|.|.|....|......|.|::.||...|.
  Fly    45 RVSPTDDEGVFKYAFKTSNG---IDVQAAGSPLETIGIYSYTSPEGVPIETRYIADELGFHVVGR 106

  Fly   125 GITVAPPTLVDETLKEEPDY 144
            .:...|||         |||
  Fly   107 HLPQPPPT---------PDY 117

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 12/49 (24%)
Cpr78CbNP_001262144.1 Chitin_bind_4 55..101 CDD:278791 12/49 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.