DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr78Ca

DIOPT Version :10

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:136 Identity:32/136 - (23%)
Similarity:47/136 - (34%) Gaps:42/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SQDYQDYQENTPRTAPLRLRANAAPARAEAPRADPVAILKQINKHNEDGSYTYGYEGADGSFKIE 86
            |.|...|..|||                    .||.            |.|::.::..:|   |.
  Fly    28 SLDRTIYYRNTP--------------------PDPF------------GHYSFEFQTTNG---IT 57

  Fly    87 TKLATGEVKGKYG---YVDETGKVRVVEYGANKYGFQPSGEGITVAPPTLVD--ETLKEEPDYAD 146
            || ..|...|..|   :|...|......|.|:..|:||:|:.|...|..::.  |.::..|. .|
  Fly    58 TK-GAGNENGAVGVVQFVSPEGIPVTFSYVADANGYQPTGDHIPAIPLHVIRQLEYIRTHPP-VD 120

  Fly   147 EPAPQR 152
            |...:|
  Fly   121 EIRSRR 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 12/49 (24%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 12/49 (24%)

Return to query results.
Submit another query.