DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr78Ca

DIOPT Version :9

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:136 Identity:32/136 - (23%)
Similarity:47/136 - (34%) Gaps:42/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SQDYQDYQENTPRTAPLRLRANAAPARAEAPRADPVAILKQINKHNEDGSYTYGYEGADGSFKIE 86
            |.|...|..|||                    .||.            |.|::.::..:|   |.
  Fly    28 SLDRTIYYRNTP--------------------PDPF------------GHYSFEFQTTNG---IT 57

  Fly    87 TKLATGEVKGKYG---YVDETGKVRVVEYGANKYGFQPSGEGITVAPPTLVD--ETLKEEPDYAD 146
            || ..|...|..|   :|...|......|.|:..|:||:|:.|...|..::.  |.::..|. .|
  Fly    58 TK-GAGNENGAVGVVQFVSPEGIPVTFSYVADANGYQPTGDHIPAIPLHVIRQLEYIRTHPP-VD 120

  Fly   147 EPAPQR 152
            |...:|
  Fly   121 EIRSRR 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 12/49 (24%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 12/49 (24%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.