DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr67Fa1

DIOPT Version :8

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster

Alignment Length:123 Identity:25/124 (20%)
Similarity:47/124 (38%) Gaps:29/124 (23%)


  Fly    69 DGSYTYGYEGADGSFKIETKLATGEVKGKYGYVDETGKVRVVEYGANKYGFQPSGEGITVAPPTL 133
            :|:|.|.||.::|....|:.:......|.:.:....|::..:.|.|::.|:||.|..:...||  
  Fly    39 EGNYNYQYETSNGIAAQESGIGGNHANGGFSWYSPEGELVQISYVADENGYQPQGALLPTPPP-- 101

  Fly   134 VDETLKEEPDYADEPAPQRPQKPYRVQRPQPRPQPRPQPQPQPQYVQYEVEEESPRRV 191
            :...:....:|.                           :..||||:.|....:.|:|
  Fly   102 IPAAILRSLEYI---------------------------RTHPQYVEQEYRRPALRKV 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 11/47 (23%)
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.