DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr65Az

DIOPT Version :8

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster

Alignment Length:205 Identity:43/206 (21%)
Similarity:64/206 (31%) Gaps:77/206 (37%)


  Fly     4 MQRVLFVGCLIVGVGMVRSQDYQDYQENTPRTAPLRLRANAAPAR-----------------AEA 51
            |:.......:.:.:|.||||. ..|....|....|.::..|.|.|                 .:.
  Fly     1 MRLTTLFSLICIAIGYVRSQP-AGYPSARPPATYLPVKPPAPPPRPPPPAPANSYGPPKKGNGKP 64

  Fly    52 PRADP--------------------------------------------VAILKQINKHNEDGSY 72
            |.|.|                                            :.|:|..:|.|.||||
  Fly    65 PPAPPKPSYGPPPKNGNGKPPPSNAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTDGSY 129

  Fly    73 TYGYEGADGSFKIE------------TKLATGEVKGKYGYVDETGKVRVVEYGANKYGFQPSGEG 125
            .|.||..:| .|.|            .:..|.|  |.:.|....|:...:.|.|::.||||.|:.
  Fly   130 MYEYETGNG-IKAEEMGYLKNAGVEGAEAQTAE--GSFSYTSPEGQEISLTYIADENGFQPQGDH 191

  Fly   126 ITVAPPTLVD 135
            :...||..::
  Fly   192 LPTPPPIPIE 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 15/59 (25%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.