DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and CG15756

DIOPT Version :8

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster

Alignment Length:176 Identity:43/177 (24%)
Similarity:62/177 (35%) Gaps:40/177 (23%)


  Fly   160 QRPQPRPQPRPQPQPQPQYVQYEVEEESPRRVQY--------APAPQPQPQPLPQPQHLPQQHHQ 216
            :||:....||...         .:...:|.|.|:        ||.|||||||   |..:.|   :
  Fly    36 RRPRRTTTPRSTT---------SITTANPDRHQHVHHWPPLVAPPPQPQPQP---PVVVVQ---K 85

  Fly   217 PSVGPAPPRLQVPGAQRTTDVLYSPLQRPARPEPDYSQTQSFGDGPSNVRISRPVYALPPASPAP 281
            ||.....|||.....||:.|..|....:.......|.:......|...|...:..|::|..:...
  Fly    86 PSHTETSPRLVDSFDQRSLDGQYEFRYQLDNGNTRYERAYWLPVGKDLVLAKKGYYSVPLPNDKY 150

  Fly   282 S----SARAQGF---LAPASGGRPLL----------EPVGFGQSQG 310
            |    :|..:|:   :...|..:|||          ..||.|...|
  Fly   151 STVFYTADHRGYHVDMQTLSVEQPLLPRSLEVPGVERDVGSGMGMG 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 9/54 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.