DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nep5 and nep-7

Sequence 1:NP_733186.2 Gene:Nep5 FlyBaseID:FBgn0039478 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_494534.2 Gene:nep-7 WormBaseID:WBGene00017552 Length:481 Species:Caenorhabditis elegans

Alignment Length:686 Identity:132/687 (19%)
Similarity:224/687 (33%) Gaps:257/687 (37%)


  Fly    84 NLIGIQSKFRRSYYHKVVLGGLLALVIILLIAI-IVISLGLK------------KSSSICRSKEC 135
            |:..::.||...:   :.|..||.:|.:.|:.: |.:::.:|            .|.::|.|.:|
 Worm     2 NVEKMREKFSSPW---IALNLLLLMVFLALVTVHIKMTVEVKPVKLDELLSNAADSRNLCESPDC 63

  Fly   136 LRTAASLIYAMDEQTDPCEDFYQFTCGRWANEHPRPDSVTSNDWFRERQAHIMRVVREFLRSNIT 200
            :..:..|:...|...|||.||:|..|||:..:    .||.|..  ::::..:.:.:||||.:|.|
 Worm    64 ITLSHELLNYQDPSVDPCVDFFQHACGRFHEQ----SSVESRT--QKKRYILQKQIREFLHNNKT 122

  Fly   201 ---KSEP---------EAVGKAKT------MYRACMDTK------LLDKR------DLEPLINYL 235
               |||.         ||:.|::.      ::....|.|      ||||.      ||..::..|
 Worm   123 STSKSENLMKLVFDKCEALQKSQNTGYLQEVHEVFNDIKKIGAWPLLDKNWDESKFDLNEMLTNL 187

  Fly   236 LRFGLPVLPSALNLTLGSGSKYATEAANVKYNWLQSIVSIKQHLTMDLIIGFDVFPDPFNRTINR 300
            ::.|                  ||.....::|:|            .||:|            |.
 Worm   188 VKLG------------------ATNFGLFQFNFL------------GLIMG------------NF 210

  Fly   301 IALGTPETDSAFPFNNDDSHKMLRKIHRKTIFMQNSDDEDDSEDDRESEEEEAAKQTSTGMTAYL 365
            :.:.        |....|..::...:   .|...|..:.|..|..||.||               
 Worm   211 VEIA--------PTEKSDVEEIQMVL---DILKGNGIEPDREEISRELEE--------------- 249

  Fly   366 HYVRKVIEKYLLYVDPNVNQEEATLGITELVKQGVRVARKVHEFKEEAENMTKPSKNPADDIVYI 430
               ..::||.|..|     :|..|:.: .|:...||..    .|......|:.||:         
 Worm   250 ---YSMLEKKLKIV-----KENETISL-NLILPDVRSV----NFSGLIAEMSHPSR--------- 292

  Fly   431 TLQDLQNQTDKNIAPKTLPIWVRYMELILKGTRHAGNIQMTQNLTIITSQADITYLQNIVEYLDD 495
                 .::....|.||                             |||::..:.:..|..|.|| 
 Worm   293 -----VSKLSGMITPK-----------------------------IITNKHPLLFETNGTESLD- 322

  Fly   496 TPASHIESYLFLSTIEELVLHTSSSMRLLHSEYMRVAIGTEGSTPRSLYCANGVNSLLGMAVSYV 560
                        :.||      |:|.|.|                        .|.|:   .:|:
 Worm   323 ------------AIIE------STSNRTL------------------------ANYLI---FNYI 342

  Fly   561 LADADFTKEKLPKVERMLSDIRRSFDRLVKSTSWMDAATKRKTIQKSAEMKSFIGFPPWLRNASV 625
            .:..|...|.....|                             ||...:|..||:|........
 Worm   343 QSSRDILTETYENCE-----------------------------QKVEAIKVIIGYPDHFDPPGT 378

  Fly   626 LNAYYEGAEVNASTHLENLMDFVHWQMMDKLNEMDKPE-PIGWATSPSNVNAFHTFQSNAITVPI 689
            |:..:|..:::::.....:...:|....::..|....| ||....:...|:|.:....||:|...
 Worm   379 LDKEFEHIDLDSTDSFYRISQKLHRLRTEQQMEFIAGETPISPVENVLEVSAHYDPSKNALTFLA 443

  Fly   690 AILQYPFYDLGLEALNYGSI---GTILGHELTHGFD 722
            ..|..||:|....  :|.::   |.|:.||:.|..|
 Worm   444 PFLDDPFFDTTYP--DYANLFLSGRIIAHEIGHSVD 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nep5NP_733186.2 PepO 146..882 CDD:226118 117/612 (19%)
M13 151..880 CDD:189000 116/607 (19%)
nep-7NP_494534.2 GluZincin 78..>477 CDD:301352 115/606 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.