DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and CG34447

DIOPT Version :8

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster

Alignment Length:297 Identity:81/298 (27%)
Similarity:137/298 (46%) Gaps:39/298 (13%)


  Fly    57 EFRSNEVSFYLY---TKQNPTEGQEITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITK 118
            |..:..:||:||   |::||     |..|...:...:|......:.:|||:.|....:.|..|..
  Fly    36 ECPNKNISFWLYSNSTRENP-----ILLDPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRP 95

  Fly   119 AWLSKGDFNVIVVNWARSQSVDYA---------MSVRAVPGAGTKVGEMIQYMHENHDMSLETLE 174
            ..|...|..||        |:||.         .:|:.:|.....:.::|..:.:...::.:.:.
  Fly    96 VLLDHEDVYVI--------SIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIH 152

  Fly   175 VIGHSLGAHVAGYAGKQVGQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGF 239
            :||.|||..|||.....| ::::..|.|||||.|||......:||...||.:|:.|.|:...:|:
  Fly   153 LIGFSLGGQVAGQTANYV-KRKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGY 216

  Fly   240 VKPIGKAAFYVSGGRKQPGC---GVDLAGTCSHARSVIYYAEAI-TENSFGAIQCQDYQAALDNE 300
            ::..|...||.:.|.|||||   .:....:|:|.|:..:|||:| |...|.|.||..:...|...
  Fly   217 LRAAGHVDFYPNFGAKQPGCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQCSGWLLQLLTL 281

  Fly   301 CGSSFSSVRMAEDTNAYNV----EGHFYVPVNSEAPF 333
            |.::.:...:     .|:|    .|.:::...|::|:
  Fly   282 CPTTGAQALL-----GYHVSDELRGSYFLQTASKSPY 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 81/296 (27%)
Pancreat_lipase_like 62..329 CDD:238363 78/287 (27%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 78/287 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116073945
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.