DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17192 and lpl

DIOPT Version :8

Sequence 1:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_002934038.1 Gene:lpl / 100127862 XenbaseID:XB-GENE-951545 Length:483 Species:Xenopus tropicalis

Alignment Length:345 Identity:99/346 (29%)
Similarity:138/346 (40%) Gaps:83/346 (24%)


  Fly    57 EFRSNEVSFYLYTKQNPTE-------GQEITADASSIVASHFNKDHGTRFVIHGW--KGKYTDSM 112
            :|.|.|..|.|.|.:.|.:       |||.|.|     ..:||....|..|||||  .|.:    
 Frog    41 DFNSIESKFSLRTLEEPDDDTCYLVPGQEHTVD-----QCNFNHTSKTFVVIHGWTVTGMF---- 96

  Fly   113 NVDITKAWLSK---------GDFNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDM 168
                 ::|:.|         .|.|||||:|.......|.:|.......|..|...|.:|.:....
 Frog    97 -----ESWVPKLVDALYKREPDSNVIVVDWLTRAQQHYPVSAEYTQLVGQDVASFIDWMDDTIQY 156

  Fly   169 SLETLEVIGHSLGAHVAGYAGKQVGQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQ-- 231
            .::.:.::|:|||||.||.|| .:..|:|:.|.|||||.|.|.|......||.:||.:|:.:.  
 Frog   157 PIDNIHILGYSLGAHAAGVAG-SLTNKKVNRITGLDPAGPTFEYAENAIILSPDDAEFVDVLHTY 220

  Fly   232 TNGGVK---GFVKPIGKAAFYVSGGRKQPGCG---------------VDLAGTCSHARSVIYYAE 278
            |.|...   |..||:|....|.:||..||||.               ||....|||.||:..:.:
 Frog   221 TRGSPDRSIGIQKPVGHIDIYPNGGSFQPGCNLGEALRLIAEKGFGDVDQLVKCSHERSIHLFID 285

  Fly   279 AI--TENSFGAIQCQDYQA--------ALDNEC---GSSFSSVRMAEDTNA-------------- 316
            ::  .|....|.:|...:|        ...|.|   |...:.||....|..              
 Frog   286 SLLYEEKPSMAYRCNSKEAFEKGLCLSCRKNRCNTLGYKVNKVRGKRSTKMYLKTRAQMPFKVFH 350

  Fly   317 YNVEGHFYVPVN---SEAPF 333
            |.|:.||:...|   ::.||
 Frog   351 YQVKVHFFAKKNLTVTDQPF 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17192NP_651522.1 Lipase 55..333 CDD:278576 98/344 (28%)
Pancreat_lipase_like 62..329 CDD:238363 95/335 (28%)
lplXP_002934038.1 lipo_lipase 41..476 CDD:132274 99/346 (29%)
Pancreat_lipase_like 45..342 CDD:238363 90/312 (29%)
PLAT 349..474 CDD:294016 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116022013
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.