DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and MSC7

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_011904.1 Gene:MSC7 SGDID:S000001081 Length:644 Species:Saccharomyces cerevisiae

Alignment Length:517 Identity:135/518 (26%)
Similarity:221/518 (43%) Gaps:70/518 (14%)


  Fly    30 EPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLS 94
            |||:.|...                 |||.:.:.......:||||..|..|.||   .|.|....
Yeast   108 EPNFIQCHC-----------------PATGQYLGSFPSKTEADIDEMVSKAGKA---QSTWGNSD 152

  Fly    95 PLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEA-LFDVTYSILTLQYYAGWTDKFFGDTI- 157
            ..:|..::..|...:..::..:|.:..:|:||...:| :.::..::..:|    ||.|.....: 
Yeast   153 FSRRLRVLASLHDYILNNQDLIARVACRDSGKTMLDASMGEILVTLEKIQ----WTIKHGQRALQ 213

  Fly   158 ------PAGGFV-----SMTRKEPVGVVGQIIPWNYPLLMLAWKWGP---ALAVGCTIIMKPAEQ 208
                  |...|:     :..|.||:||:..|:.||||...|.   ||   ||..|..|::|.:||
Yeast   214 PSRRPGPTNFFMKWYKGAEIRYEPLGVISSIVSWNYPFHNLL---GPIIAALFTGNAIVVKCSEQ 275

  Fly   209 TPLTALHMAALAKE----AGFPAGVINVVNGFGPT----AGAAISAHPDIAKVAFTGSVEIGRIV 265
            ...::.....|.::    ......::.:.....||    :....::||....:.|.||..:...:
Yeast   276 VVWSSEFFVELIRKCLEACDEDPDLVQLCYCLPPTENDDSANYFTSHPGFKHITFIGSQPVAHYI 340

  Fly   266 MQAAATSNLKRVSLELGGKSPVVVFDDA-DIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDE 329
            ::.||.| |..|.:|||||...:|.|.| ::|..........|.:.||:|....|..|.::.||:
Yeast   341 LKCAAKS-LTPVVVELGGKDAFIVLDSAKNLDALSSIIMRGTFQSSGQNCIGIERVIVSKENYDD 404

  Fly   330 FVAKAAAKAKARKVGNPFEQ--------NVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRI 386
            .|    .....|...||..|        ||..|..|.|:...::...::....:||:|..||.|.
Yeast   405 LV----KILNDRMTANPLRQGSDIDHLENVDMGAMISDNRFDELEALVKDAVAKGARLLQGGSRF 465

  Fly   387 GN----VGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITND 447
            .:    .|.:.:||:..||..:|:|||.|:|||:..:.|..:.:..:..||:..:||...|...|
Yeast   466 KHPKYPQGHYFQPTLLVDVTPEMKIAQNEVFGPILVMMKAKNTDHCVQLANSAPFGLGGSVFGAD 530

  Fly   448 INKALKFANNVDAGSVWINCYDA-VLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMKLL 508
            |.:....||::..|:|.||.:.. .:...||||...||.|:..|::||......|::....|
Yeast   531 IKECNYVANSLQTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGLLGLCNAKSVCFDTL 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 131/511 (26%)
MSC7NP_011904.1 ALDH_F15-22 115..590 CDD:143416 130/507 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S334
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.