DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and ALD6

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_015264.1 Gene:ALD6 SGDID:S000005982 Length:500 Species:Saccharomyces cerevisiae

Alignment Length:474 Identity:217/475 (46%)
Similarity:308/475 (65%) Gaps:3/475 (1%)


  Fly    36 LFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTN 100
            |||||:|:.:..|||:...:|:|...:.:||.....|::.|::.|.:||| |:||....|.:|..
Yeast    28 LFINNKFMKAQDGKTYPVEDPSTENTVCEVSSATTEDVEYAIECADRAFH-DTEWATQDPRERGR 91

  Fly   101 LMNKLCALMDRDKAFLASLETQDNGKPYAEALFDVTYSILTLQYYAGWTDKFFGDTIPAG-GFVS 164
            |::||...::.....::|:|..||||..|.|..|||.:|..|:..|.:.||..|.||..| |:::
Yeast    92 LLSKLADELESQIDLVSSIEALDNGKTLALARGDVTIAINCLRDAAAYADKVNGRTINTGDGYMN 156

  Fly   165 MTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAGFPAGV 229
            .|..||:||.|||||||:|::|||||..||||:|...|:|||..|||.||:.|:|.|:.|.||||
Yeast   157 FTTLEPIGVCGQIIPWNFPIMMLAWKIAPALAMGNVCILKPAAVTPLNALYFASLCKKVGIPAGV 221

  Fly   230 INVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDAD 294
            :|:|.|.|.|.|||::..|.|.|:|||||.|:|:.|...::.||||:::|||||||..:|||||:
Yeast   222 VNIVPGPGRTVGAALTNDPRIRKLAFTGSTEVGKSVAVDSSESNLKKITLELGGKSAHLVFDDAN 286

  Fly   295 IDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKAR-KVGNPFEQNVQQGPQID 358
            |...:......:|.|.||.|.:|||.||.|.||||.:|...|..:.. ||||||::...||...:
Yeast   287 IKKTLPNLVNGIFKNAGQICSSGSRIYVQEGIYDELLAAFKAYLETEIKVGNPFDKANFQGAITN 351

  Fly   359 DDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFS 423
            ......::.||:.|||||||:..||:::|:.|:|:.||||.||.:||||.:|||||||.::.||.
Yeast   352 RQQFDTIMNYIDIGKKEGAKILTGGEKVGDKGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFK 416

  Fly   424 SLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSGIGRE 488
            :|||.::.||:.::||.:|:.|..::..||.|..:.||:||||.|:......||||.|.||.|||
Yeast   417 TLEEGVEMANSSEFGLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGRE 481

  Fly   489 LGKDGLDNYLETKTITMKL 507
            :|::....|.|.|.:.:||
Yeast   482 MGEEVYHAYTEVKAVRIKL 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 215/472 (46%)
ALD6NP_015264.1 ALDH_F1-2_Ald2-like 23..498 CDD:143410 215/471 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99442452
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 472 1.000 Inparanoid score I227
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133772
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11699
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.