DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and ALDH10A8

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_565094.1 Gene:ALDH10A8 AraportID:AT1G74920 Length:501 Species:Arabidopsis thaliana

Alignment Length:480 Identity:201/481 (42%)
Similarity:280/481 (58%) Gaps:10/481 (2%)


  Fly    35 QLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRD--SEWRKLSPLQ 97
            ||||:.|:.:.:..|.....||||.:.|..:......|:|:||.||::|..|:  .:|.|.....
plant     9 QLFIDGEWREPILKKRIPIVNPATEEVIGDIPAATTEDVDVAVNAARRALSRNKGKDWAKAPGAV 73

  Fly    98 RTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALFDVTYSILTLQYYAGWTDKFFGD-----TI 157
            |...:..:.|.::..|..||.||..|.|||..||::|:.......::||...:.....     ::
plant    74 RAKYLRAIAAKVNERKTDLAKLEALDCGKPLDEAVWDMDDVAGCFEFYADLAEGLDAKQKAPVSL 138

  Fly   158 PAGGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKE 222
            |...|.|...|:|:||||.|.||||||||..||..|:||.|||.|:||:|...:|.|.:|.:.:|
plant   139 PMESFKSYVLKQPLGVVGLITPWNYPLLMAVWKVAPSLAAGCTAILKPSELASVTCLELADICRE 203

  Fly   223 AGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPV 287
            .|.|.||:||:.|||..|||.:::||.:.|:|||||...|..||.||| ..:|.||:|||||||:
plant   204 VGLPPGVLNVLTGFGSEAGAPLASHPGVDKIAFTGSFATGSKVMTAAA-QLVKPVSMELGGKSPL 267

  Fly   288 VVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQ 352
            :||||.|:|.|.|......|..:||.|.|.||..|||.|..||:.|....:|..|:.:|.|:..:
plant   268 IVFDDVDLDKAAEWALFGCFWTNGQICSATSRLLVHESIASEFIEKLVKWSKNIKISDPMEEGCR 332

  Fly   353 QGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNV--GFFVEPTVFSDVKDDMRIAQEEIFGP 415
            .||.:......|:|.:|.:.|.|||.:..||.|..::  |||:|||:.:||...|:|.:||:|||
plant   333 LGPVVSKGQYEKILKFISTAKSEGATILHGGSRPEHLEKGFFIEPTIITDVTTSMQIWREEVFGP 397

  Fly   416 VQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGY 480
            |..:..|:|.:|.|:.||:..|||.|.||:||..:..:.:...:||.|||||........|:||.
plant   398 VLCVKTFASEDEAIELANDSHYGLGAAVISNDTERCDRISEAFEAGIVWINCSQPCFTQAPWGGV 462

  Fly   481 KHSGIGRELGKDGLDNYLETKTITM 505
            |.||.|||||:.||||||..|.:|:
plant   463 KRSGFGRELGEWGLDNYLSVKQVTL 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 201/481 (42%)
ALDH10A8NP_565094.1 PLN02467 1..501 CDD:215260 201/481 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.