DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and ALDH2B7

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_564204.1 Gene:ALDH2B7 AraportID:AT1G23800 Length:534 Species:Arabidopsis thaliana

Alignment Length:489 Identity:262/490 (53%)
Similarity:346/490 (71%) Gaps:12/490 (2%)


  Fly    21 KFDHTYAQCEPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFH 85
            |.:||         ||.|...|||:||||||.|.:|...:.|.||||||..|::.||.||:|||.
plant    50 KVEHT---------QLLIGGRFVDAVSGKTFPTLDPRNGEVIAQVSEGDAEDVNRAVAAARKAFD 105

  Fly    86 RDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAE-ALFDVTYSILTLQYYAGWT 149
             :..|.|::..:|:.::.:...|:::....:|:|||.||||||.: |..:|.......:|||||.
plant   106 -EGPWPKMTAYERSKILFRFADLIEKHNDEIAALETWDNGKPYEQSAQIEVPMLARVFRYYAGWA 169

  Fly   150 DKFFGDTIPAGG-FVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTA 213
            ||..|.|:|..| ....|..||:||.|||||||:|||||:||.|||||.|.|:::|.||||||:|
plant   170 DKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTVVLKTAEQTPLSA 234

  Fly   214 LHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVS 278
            |.:..|..|||.|.||:|:|:|||.||||||::|.|:.|||||||.::|:|:::.|:.||||.|:
plant   235 LLVGKLLHEAGLPDGVVNIVSGFGATAGAAIASHMDVDKVAFTGSTDVGKIILELASKSNLKAVT 299

  Fly   279 LELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKV 343
            ||||||||.:|.:|||:|.|||..|.|||.|.||.|||||||:|||::|||||.||.|:|..|.|
plant   300 LELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRNV 364

  Fly   344 GNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIA 408
            |:||:..::||||:|.:...|:|.||:.|.:.||.|||||.|:|:.|::::|||||||||||.||
plant   365 GDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVKDDMLIA 429

  Fly   409 QEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLP 473
            .:|||||||:|.||..|:|:|.||||.:|||||||.|.:::.|.:....:..|:|||||:|.:..
plant   430 TDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGTVWINCFDVLDA 494

  Fly   474 STPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 507
            |.||||||.||||||.|...|:|||:.|.:...|
plant   495 SIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSL 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 258/475 (54%)
ALDH2B7NP_564204.1 PLN02466 1..534 CDD:215259 262/490 (53%)
ALDH_F2BC 51..526 CDD:143460 260/485 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 O PTHR11699
Phylome 1 0.910 0.833 Consistency score
54.920

Return to query results.
Submit another query.