DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and ALDH2B4

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_190383.1 Gene:ALDH2B4 AraportID:AT3G48000 Length:538 Species:Arabidopsis thaliana

Alignment Length:478 Identity:263/479 (55%)
Similarity:343/479 (72%) Gaps:3/479 (1%)


  Fly    32 NYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPL 96
            ::.||.||..||||.|||||.|.:|.|.:.|..|:|||..||:.|||||:.||. :..|.|:|..
plant    56 SHTQLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVKAARTAFD-EGPWPKMSAY 119

  Fly    97 QRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEAL-FDVTYSILTLQYYAGWTDKFFGDTIPA- 159
            :|:.::.:...|:::....||||||.||||||.::| .::.......:|||||.||..|.|||| 
plant   120 ERSRVLLRFADLVEKHSEELASLETWDNGKPYQQSLTAEIPMFARLFRYYAGWADKIHGLTIPAD 184

  Fly   160 GGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAG 224
            |.:...|..||:||.|||||||:||||.|||.|||||.|.||::|.||||||||.:...|..|||
plant   185 GNYQVHTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTAFYAGKLFLEAG 249

  Fly   225 FPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVV 289
            .|.||:|:|:|||.|||||:::|.|:.|:|||||.:.|::::..||.||||.|:||||||||.:|
plant   250 LPPGVLNIVSGFGATAGAALASHMDVDKLAFTGSTDTGKVILGLAANSNLKPVTLELGGKSPFIV 314

  Fly   290 FDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQG 354
            |:|||||.|||..|.|||.|.||.|||||||:||||:|||||.|:.|:|..|.||:||.:.::||
plant   315 FEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSKARALKRVVGDPFRKGIEQG 379

  Fly   355 PQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSI 419
            ||||.....||:.||:||.:..|.|:.||.:||:.|:|::|||||:|||||.|||:|||||||||
plant   380 PQIDLKQFEKVMKYIKSGIESNATLECGGDQIGDKGYFIQPTVFSNVKDDMLIAQDEIFGPVQSI 444

  Fly   420 FKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSG 484
            .|||.::|:|.|||..:|||||||.|.:::.|.:.:..:.||:||:||:|....:.||||||.||
plant   445 LKFSDVDEVIKRANETKYGLAAGVFTKNLDTANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSG 509

  Fly   485 IGRELGKDGLDNYLETKTITMKL 507
            .|||.|...|:|||:.|.:...|
plant   510 NGREKGIYSLNNYLQIKAVVTAL 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 262/475 (55%)
ALDH2B4NP_190383.1 PLN02466 1..538 CDD:215259 263/479 (55%)
ALDH_F2BC 55..530 CDD:143460 262/475 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 O PTHR11699
Phylome 1 0.910 0.833 Consistency score
54.920

Return to query results.
Submit another query.