DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31075 and aldh1a3

Sequence 1:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001038210.1 Gene:aldh1a3 ZFINID:ZDB-GENE-061128-2 Length:513 Species:Danio rerio

Alignment Length:480 Identity:269/481 (56%)
Similarity:345/481 (72%) Gaps:2/481 (0%)


  Fly    30 EPNYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLS 94
            |..:.::|||||:..|..||.|.|.||||..:|..:.|.||||:|.||||||.|..|.|.||::.
Zfish    28 EIKHTKIFINNEWHTSSKGKQFPTINPATGVKICDIEEADKADVDEAVKAAKAAGQRGSVWRRMD 92

  Fly    95 PLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALF-DVTYSILTLQYYAGWTDKFFGDTIP 158
            ...|..|:|:|..|::|::|.||:||::|.|||:..|.| |:..||.||:||||||||..|.|:|
Zfish    93 ASSRGRLLNRLADLLERERAVLATLESKDTGKPFLHAFFVDLDGSIKTLRYYAGWTDKIHGKTMP 157

  Fly   159 AG-GFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKE 222
            .. .||..|:.||:||.|.|||||:|||||.||..||||.|.|:::||||||||||||:|||.||
Zfish   158 VDENFVCFTKHEPIGVCGAIIPWNFPLLMLMWKIAPALACGNTVVLKPAEQTPLTALHVAALIKE 222

  Fly   223 AGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPV 287
            ||||.||:|||.||||||||||:.|.:|.|:|||||.|:|::|..|||:||||||:||||||:|.
Zfish   223 AGFPPGVVNVVPGFGPTAGAAIAGHMNIDKLAFTGSTEVGQLVKAAAASSNLKRVTLELGGKNPC 287

  Fly   288 VVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQ 352
            :||.|:|:..|||.|.:..|.|.||:|.|.||.||.|.:|:|||..:..:||...:|:|.|....
Zfish   288 IVFADSDLQLAVEETQKGAFFNQGQACTAASRVYVQEPVYEEFVRLSVERAKNIVIGDPMEPRTS 352

  Fly   353 QGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQ 417
            .|||||.....|:|..::|||||||||:.||..:.:.|.|:.||:||||||.||||:||||||||
Zfish   353 HGPQIDQHQFEKILALVDSGKKEGAKLEFGGCAVEDRGLFIHPTIFSDVKDHMRIAKEEIFGPVQ 417

  Fly   418 SIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKH 482
            .|.||...:::|||||:.|:||.|.|.|.|:.:|:..:..::||:||:|||:|:...|||||||.
Zfish   418 CIMKFECQQDVIDRANSSQFGLTAAVFTRDVQRAMSVSAALEAGTVWVNCYNALHAQTPFGGYKM 482

  Fly   483 SGIGRELGKDGLDNYLETKTITMKL 507
            ||.|||||:..|..|.|.|.||:||
Zfish   483 SGNGRELGEYALAEYTEVKAITIKL 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 266/475 (56%)
aldh1a3NP_001038210.1 ALDH_F1AB_F2_RALDH1 28..506 CDD:143459 267/478 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153834at2759
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.